Lepirudin

Lepirudin
Clinical data
Trade names	Refludan
AHFS/Drugs.com	Monograph
Routes of; administration	SQ or IV
ATC code	B01AE02 (WHO) ;
Legal status
Legal status	US: ℞-only;
Pharmacokinetic data
Bioavailability	100
Elimination half-life	~1.3 hours
Excretion	Renal
Identifiers
	IUPAC name [Leu1,Thr2]-63-desulfohirudin;
CAS Number	138068-37-8 ;
IUPHAR/BPS	6469;
DrugBank	DB00001 ;
ChemSpider	none;
UNII	Y43GF64R34;
KEGG	D03692 ;
ChEBI	CHEBI:142437;
ChEMBL	ChEMBL1201666 ;
CompTox Dashboard (EPA)	DTXSID50160461 ;
Chemical and physical data
Formula	C288H448N80O110S6
Molar mass	6983.56 g·mol−1
	(what is this?) (verify)

Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor.

Brand name: Refludan, Generic: Lepirudin rDNA for injection.

Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63.

Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.